Lineage for d4xdza2 (4xdz A:184-329)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006836Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries)
  8. 2006837Domain d4xdza2: 4xdz A:184-329 [271789]
    Other proteins in same PDB: d4xdza1, d4xdzb1
    automated match to d1np3a1
    complexed with 40e, epe, gol, mg, ndp

Details for d4xdza2

PDB Entry: 4xdz (more details), 1.15 Å

PDB Description: holo structure of ketol-acid reductoisomerase from ignisphaera aggregans
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdza2 a.100.1.0 (A:184-329) automated matches {Ignisphaera aggregans [TaxId: 583356]}
fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg
ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf
kelselegstietvgrklremmfrgm

SCOPe Domain Coordinates for d4xdza2:

Click to download the PDB-style file with coordinates for d4xdza2.
(The format of our PDB-style files is described here.)

Timeline for d4xdza2:

2006837
d4xdza2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4xdza1