Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [276376] (2 PDB entries) |
Domain d4xb3a2: 4xb3 A:464-536 [276384] Other proteins in same PDB: d4xb3a1 automated match to d2zida2 complexed with ca, p6g |
PDB Entry: 4xb3 (more details), 2.09 Å
SCOPe Domain Sequences for d4xb3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xb3a2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans [TaxId: 210007]} adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh klqpwdafcikil
Timeline for d4xb3a2: