Lineage for d4xb3a2 (4xb3 A:464-536)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.0: automated matches [227134] (1 protein)
not a true familyProtein automated matches [226835] (41 species)
not a true protein
Species Streptococcus mutans [TaxId:210007] [276376] (2 PDB entries) 
Domain d4xb3a2: 4xb3 A:464-536 [276384]
Other proteins in same PDB: d4xb3a1
automated match to d2zida2
complexed with ca, p6g
Details for d4xb3a2
PDB Entry: 4xb3 (more details), 2.09 Å
PDB Description: structure of dextran glucosidase
PDB Compounds: (A:) glucan 1,6-alpha-glucosidaseSCOPe Domain Sequences for d4xb3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xb3a2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans [TaxId: 210007]}
adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh
klqpwdafcikil
SCOPe Domain Coordinates for d4xb3a2:
Click to download the PDB-style file with coordinates for d4xb3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xb3a2:
- d4xb3a2 first appeared in SCOPe 2.05
- d4xb3a2 appears in SCOPe 2.07
View in 3D
