Lineage for d4x9xa_ (4x9x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921799Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2921800Protein automated matches [190655] (13 species)
    not a true protein
  7. 2921844Species Staphylococcus aureus [TaxId:196620] [311773] (1 PDB entry)
  8. 2921845Domain d4x9xa_: 4x9x A: [311774]
    automated match to d3jr7a_
    complexed with edo, ola

Details for d4x9xa_

PDB Entry: 4x9x (more details), 1.2 Å

PDB Description: biochemical roles for conserved residues in the bacterial fatty acid binding protein family
PDB Compounds: (A:) DegV domain-containing protein MW1315

SCOPe Domain Sequences for d4x9xa_:

Sequence, based on SEQRES records: (download)

>d4x9xa_ c.119.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
tkqiivtdstsdlskeyleannihviplsltiegasyvdqvditseefinhiendedvkt
sqpaigefisayeelgkdgseiisihlssglsgtyntayqasqmvdanvtvidsksisfg
lgyqiqhlvelvkegvstseivkklnhlreniklfvvigqlnqlikggrisktkglignl
mkikpigtlddgrlelvhnartqnssiqylkkeiaefigdheiksigvahanvieyvdkl
kkvfneafhvnnydinvttpvisahtgqgaiglvvlkk

Sequence, based on observed residues (ATOM records): (download)

>d4x9xa_ c.119.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
tkqiivtdstsdlskeyleannihviplsltiegasyvdqvditseefinhiendedvkt
sqpaigefisayeelgkdgseiisihlssglsgtyntayqasqmvdanvtvidsksisfg
lgyqiqhlvelvkegvstseivkklnhlreniklfvvigqlnqlikggriskikpigtld
dgrlelvhnartqnssiqylkkeiaefigdheiksigvahanvieyvdklkkvfneafhv
nnydinvttpvisahtgqgaiglvvlkk

SCOPe Domain Coordinates for d4x9xa_:

Click to download the PDB-style file with coordinates for d4x9xa_.
(The format of our PDB-style files is described here.)

Timeline for d4x9xa_: