Lineage for d4x7ua_ (4x7u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894401Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
    Pfam PF05711
  6. 2894414Protein Mycinamicin III 3'-O-methyltransferase MycF [310830] (1 species)
  7. 2894415Species Micromonospora griseorubida [TaxId:28040] [311099] (8 PDB entries)
  8. 2894424Domain d4x7ua_: 4x7u A: [309975]
    complexed with mg, sah, zm3

Details for d4x7ua_

PDB Entry: 4x7u (more details), 1.65 Å

PDB Description: mycf mycinamicin iii 3'-o-methyltransferase in complex with mg, sah and mycinamicin iii (substrate)
PDB Compounds: (A:) Mycinamicin III 3''-O-methyltransferase

SCOPe Domain Sequences for d4x7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x7ua_ c.66.1.61 (A:) Mycinamicin III 3'-O-methyltransferase MycF {Micromonospora griseorubida [TaxId: 28040]}
pstgvelyldllkrtvsnfiyqdathvagliteaafveearesgedyptvahtmigmkrl
nnlqhcvesalrdgvpgdvletgvwrggacifargilkaydvrdrtvwvadsfqgfpkit
dddhpmdaemnlhqyneavdlptslatvqrnfsrygllddqvrflpgwfkdtmptapfer
lavlrmdgdsygatmdvlthayprlspggfaiiddycipacreavheyrdrhgisdeive
idrqgvywrrsa

SCOPe Domain Coordinates for d4x7ua_:

Click to download the PDB-style file with coordinates for d4x7ua_.
(The format of our PDB-style files is described here.)

Timeline for d4x7ua_: