Lineage for d4x7ua_ (4x7u A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
Pfam PF05711
Protein Mycinamicin III 3'-O-methyltransferase MycF [310830] (1 species) Species Micromonospora griseorubida [TaxId:28040] [311099] (8 PDB entries) 
Domain d4x7ua_: 4x7u A: [309975]
complexed with mg, sah, zm3
Details for d4x7ua_
PDB Entry: 4x7u (more details), 1.65 Å
PDB Description: mycf mycinamicin iii 3'-o-methyltransferase in complex with mg, sah and mycinamicin iii (substrate)
PDB Compounds: (A:) Mycinamicin III 3''-O-methyltransferaseSCOPe Domain Sequences for d4x7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x7ua_ c.66.1.61 (A:) Mycinamicin III 3'-O-methyltransferase MycF {Micromonospora griseorubida [TaxId: 28040]}
pstgvelyldllkrtvsnfiyqdathvagliteaafveearesgedyptvahtmigmkrl
nnlqhcvesalrdgvpgdvletgvwrggacifargilkaydvrdrtvwvadsfqgfpkit
dddhpmdaemnlhqyneavdlptslatvqrnfsrygllddqvrflpgwfkdtmptapfer
lavlrmdgdsygatmdvlthayprlspggfaiiddycipacreavheyrdrhgisdeive
idrqgvywrrsa
SCOPe Domain Coordinates for d4x7ua_:
Click to download the PDB-style file with coordinates for d4x7ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4x7ua_:
- d4x7ua_ first appeared in SCOPe 2.06
- d4x7ua_ appears in SCOPe 2.07
View in 3D
