Lineage for d4x31a_ (4x31 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3023178Protein automated matches [190122] (8 species)
    not a true protein
  7. 3023204Species Halobacterium salinarum [TaxId:64091] [270103] (7 PDB entries)
  8. 3023209Domain d4x31a_: 4x31 A: [270104]
    automated match to d1cwqa_
    complexed with li1, ret

Details for d4x31a_

PDB Entry: 4x31 (more details), 2.4 Å

PDB Description: room temperature structure of bacteriorhodopsin from lipidic cubic phase obtained with serial millisecond crystallography using synchrotron radiation
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d4x31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x31a_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 64091]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgea

SCOPe Domain Coordinates for d4x31a_:

Click to download the PDB-style file with coordinates for d4x31a_.
(The format of our PDB-style files is described here.)

Timeline for d4x31a_: