Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein automated matches [190122] (8 species) not a true protein |
Species Halobacterium salinarum [TaxId:64091] [270103] (7 PDB entries) |
Domain d4x31a_: 4x31 A: [270104] automated match to d1cwqa_ complexed with li1, ret |
PDB Entry: 4x31 (more details), 2.4 Å
SCOPe Domain Sequences for d4x31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x31a_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 64091]} tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgea
Timeline for d4x31a_: