Lineage for d4wy4b_ (4wy4 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040337Family h.1.15.0: automated matches [254266] (1 protein)
    not a true family
  6. 3040338Protein automated matches [254614] (3 species)
    not a true protein
  7. 3040339Species Human (Homo sapiens) [TaxId:9606] [270047] (2 PDB entries)
  8. 3040341Domain d4wy4b_: 4wy4 B: [270048]
    automated match to d2npsb_

Details for d4wy4b_

PDB Entry: 4wy4 (more details), 1.4 Å

PDB Description: crystal structure of autophagic snare complex
PDB Compounds: (B:) Syntaxin-17

SCOPe Domain Sequences for d4wy4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wy4b_ h.1.15.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eswetleadlielsqlvtdfsllvnsqqekidsiadhvnsaavnveegtknlgkaaky

SCOPe Domain Coordinates for d4wy4b_:

Click to download the PDB-style file with coordinates for d4wy4b_.
(The format of our PDB-style files is described here.)

Timeline for d4wy4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wy4a_