Lineage for d4wxkc_ (4wxk C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3001072Protein automated matches [190200] (9 species)
    not a true protein
  7. 3001098Species Haemophilus influenzae [TaxId:281310] [279491] (2 PDB entries)
  8. 3001101Domain d4wxkc_: 4wxk C: [279495]
    automated match to d1bs4a_
    complexed with gol, ni

Details for d4wxkc_

PDB Entry: 4wxk (more details), 2.05 Å

PDB Description: crystal structure of a peptide deformylase from haemophilus influenzae
PDB Compounds: (C:) Peptide deformylase

SCOPe Domain Sequences for d4wxkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxkc_ d.167.1.1 (C:) automated matches {Haemophilus influenzae [TaxId: 281310]}
mtalnvliypddhlkvvcepvtevndairkivddmfdtmyqekgiglaapqvdilqriit
idvegdkqnqfvlinpeilasegetgieegclsipgfralvprkekvtvraldrdgkeft
ldadgllaiciqheidhlngilfvdylsplkrqrikeklikykkqi

SCOPe Domain Coordinates for d4wxkc_:

Click to download the PDB-style file with coordinates for d4wxkc_.
(The format of our PDB-style files is described here.)

Timeline for d4wxkc_: