Lineage for d4wuta_ (4wut A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1878796Species Agrobacterium vitis [TaxId:311402] [261009] (3 PDB entries)
  8. 1878797Domain d4wuta_: 4wut A: [262131]
    automated match to d2fn8a_
    complexed with ca, cl, fcb

Details for d4wuta_

PDB Entry: 4wut (more details), 1.5 Å

PDB Description: crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
PDB Compounds: (A:) ABC transporter substrate binding protein (Ribose)

SCOPe Domain Sequences for d4wuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuta_ c.93.1.0 (A:) automated matches {Agrobacterium vitis [TaxId: 311402]}
geiavivktvnstfwqnvqkgadaaigkqkahtitfqgpaaesaiadqvnmvenavnrkv
daillapsdpdalvpavkkawearipvviidsmlskdaekyyqaflatdnkaagelaaka
miqkvgtegkiavmsyvagagseigrvggftdyikansklqivgpyysqsqmatalnqtt
dvlaanadlkgifganeptaigmgraikqagkagklvaigfdgnqdlqefvkdgtleatv
vqgsyqmgekgvdtllkllskekvekfidtgvvvvtkqnidkpeaknvly

SCOPe Domain Coordinates for d4wuta_:

Click to download the PDB-style file with coordinates for d4wuta_.
(The format of our PDB-style files is described here.)

Timeline for d4wuta_: