Lineage for d4wmea_ (4wme A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2408004Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (14 PDB entries)
  8. 2408006Domain d4wmea_: 4wme A: [272742]
    automated match to d2ynaa_
    complexed with edo

Details for d4wmea_

PDB Entry: 4wme (more details), 1.55 Å

PDB Description: crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2
PDB Compounds: (A:) MERS-CoV 3CL protease

SCOPe Domain Sequences for d4wmea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wmea_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
mgvvmq

SCOPe Domain Coordinates for d4wmea_:

Click to download the PDB-style file with coordinates for d4wmea_.
(The format of our PDB-style files is described here.)

Timeline for d4wmea_: