![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (36 species) not a true protein |
![]() | Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (21 PDB entries) |
![]() | Domain d4wmea_: 4wme A: [272742] automated match to d2ynaa_ complexed with edo |
PDB Entry: 4wme (more details), 1.55 Å
SCOPe Domain Sequences for d4wmea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wmea_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]} sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi mgvvmq
Timeline for d4wmea_: