Lineage for d4wl3a_ (4wl3 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. Protein automated matches [190509] (19 species)
    not a true protein
  7. Species Enterococcus faecalis [TaxId:565637] [279343] (3 PDB entries)
  8. Domain d4wl3a_: 4wl3 A: [279346]
    automated match to d2bjfa_

Details for d4wl3a_

PDB Entry: 4wl3 (more details), 2.01 Å

PDB Description: crystal structure determination of bile salt hydrolase from enterococcus feacalis
PDB Compounds: (A:) Bile salt hydrolase

SCOPe Domain Sequences for d4wl3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wl3a_ d.153.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 565637]}
ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
enlekdslivypmvetqqinyan

SCOPe Domain Coordinates for d4wl3a_ are not available.

Timeline for d4wl3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wl3b_, d4wl3c_, d4wl3d_