Lineage for d4wiua1 (4wiu A:-1-244)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domainSuperfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) 
Family c.109.1.0: automated matches [227144] (1 protein)
not a true familyProtein automated matches [226847] (5 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:419947] [260615] (7 PDB entries) 
Domain d4wiua1: 4wiu A:-1-244 [260616]
Other proteins in same PDB: d4wiua2
automated match to d1khba2
complexed with gol, mn, oxl
Details for d4wiua1
PDB Entry: 4wiu (more details), 2.02 Å
PDB Description: crystal structure of pepck (rv0211) from mycobacterium tuberculosis in complex with oxalate and mn2+
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]SCOPe Domain Sequences for d4wiua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wiua1 c.109.1.0 (A:-1-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
mahdeg
SCOPe Domain Coordinates for d4wiua1:
Click to download the PDB-style file with coordinates for d4wiua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wiua1:
- d4wiua1 first appeared in SCOPe 2.04
- d4wiua1 appears in SCOPe 2.06
- d4wiua1 appears in the current release, SCOPe 2.08
View in 3D
