Lineage for d4wenb_ (4wen B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743852Domain d4wenb_: 4wen B: [271543]
    automated match to d4ldeb_

Details for d4wenb_

PDB Entry: 4wen (more details), 1.89 Å

PDB Description: co-complex structure of the f4 fimbrial adhesin faeg variant ac with llama single domain antibody v2
PDB Compounds: (B:) Anti-F4+ETEC bacteria VHH variable region

SCOPe Domain Sequences for d4wenb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wenb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlsctasgsissinamgwyrqapgskrefvahitntgvtefa
dsvkgrftisrdnakttvdlqmnslkpedtavyycaatdwgtllikgidhwgkgtqvtvs
s

SCOPe Domain Coordinates for d4wenb_:

Click to download the PDB-style file with coordinates for d4wenb_.
(The format of our PDB-style files is described here.)

Timeline for d4wenb_: