Lineage for d4we4a_ (4we4 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) Protein Hemagglutinin [49824] (22 species)
includes rudiment esterase domainSpecies Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) 
Domain d4we4a_: 4we4 A: [309821]
Other proteins in same PDB: d4we4b_
automated match to d4unyc_
complexed with nag, pe5, peg
Details for d4we4a_
PDB Entry: 4we4 (more details), 2.35 Å
PDB Description: the crystal structure of hemagglutinin from 1968 h3n2 influenza virus
PDB Compounds: (A:) Hemagglutinin HA1 chainSCOPe Domain Sequences for d4we4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4we4a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqtq
SCOPe Domain Coordinates for d4we4a_:
Click to download the PDB-style file with coordinates for d4we4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4we4a_:
- d4we4a_ first appeared in SCOPe 2.06
- d4we4a_ appears in SCOPe 2.07
View in 3D
