Lineage for d4wd7b_ (4wd7 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029261Fold f.67: Bestropin channel-like [418719] (1 superfamily)
    four transmembrane helices; forms pentameric pore channel
  4. 3029262Superfamily f.67.1: Bestropin channel-like [418750] (1 family) (S)
  5. 3029263Family f.67.1.1: Bestropin channel-like [418819] (3 proteins)
    Pfam PF01062
  6. 3029291Protein Klebsiella pneumoniae Bestropin homolog KpBest [419138] (1 species)
  7. 3029292Species Klebsiella pneumoniae UHKPC96 [TaxId:1284795] [419660] (2 PDB entries)
  8. 3029299Domain d4wd7b_: 4wd7 B: [414401]
    complexed with zn

Details for d4wd7b_

PDB Entry: 4wd7 (more details), 2.9 Å

PDB Description: crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae by zn-sad phasing
PDB Compounds: (B:) Bestrophin domain protein

SCOPe Domain Sequences for d4wd7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wd7b_ f.67.1.1 (B:) Klebsiella pneumoniae Bestropin homolog KpBest {Klebsiella pneumoniae UHKPC96 [TaxId: 1284795]}
skiifrlllnvlmsiiaiisyqwyeqlgihltvapfsllgiaiaiflgfrnsasysrfve
arnlwgtvliaertlvrqlrnilpaehdahrrivsylvafswslkhqlrktdptadlrrl
lpeervteilassmptnrilllagneigqlreagklsdityglmdnkldelahvlggcer
lattpvpfaytlilqrtvylfctllpfalvgdlhymtpfvsvfisytflswdslaeeled
pfgtaandlplnamcntiernlldmtgqhp

SCOPe Domain Coordinates for d4wd7b_:

Click to download the PDB-style file with coordinates for d4wd7b_.
(The format of our PDB-style files is described here.)

Timeline for d4wd7b_:

  • d4wd7b_ is new in SCOPe 2.08-stable