Lineage for d4wd6b_ (4wd6 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (31 species)
not a true protein
Species Pseudomonas stutzeri [TaxId:316] [259737] (2 PDB entries) 
Domain d4wd6b_: 4wd6 B: [264103]
automated match to d1jjtb_
complexed with zn
Details for d4wd6b_
PDB Entry: 4wd6 (more details), 2.2 Å
PDB Description: Crystal Structure of DIM-1 metallo-beta-lactamase
PDB Compounds: (B:) metallo-beta-lactamaseSCOPe Domain Sequences for d4wd6b_:
Sequence, based on SEQRES records: (download)
>d4wd6b_ d.157.1.0 (B:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
evpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvhw
irkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgne
stlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsrs
aqnalsryseaqivipghgkigdiallkhtkslaetas
Sequence, based on observed residues (ATOM records): (download)
>d4wd6b_ d.157.1.0 (B:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
evpelriekvkeniflhtsysrglvssnglvvidkgnafivdtpwsdrdtetlvhwirkn
gyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgnestlv
dglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsrsaqna
lsryseaqivipghgkigdiallkhtkslaetas
SCOPe Domain Coordinates for d4wd6b_:
Click to download the PDB-style file with coordinates for d4wd6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wd6b_:
- d4wd6b_ first appeared in SCOPe 2.05
- d4wd6b_ appears in SCOPe 2.07
View in 3D
