Lineage for d4wbsa_ (4wbs A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (130 species)
not a true protein
Species Burkholderia phymatum [TaxId:391038] [260120] (1 PDB entry) 
Domain d4wbsa_: 4wbs A: [260121]
automated match to d2d2fa_
complexed with cl
Details for d4wbsa_
PDB Entry: 4wbs (more details), 2 Å
PDB Description: crystal structure of an abc transporter related protein from burkholderia phymatum
PDB Compounds: (A:) ABC transporter relatedSCOPe Domain Sequences for d4wbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbsa_ c.37.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 391038]}
ssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagei
dldgksisllpihkraslglsylpqeasvfrklsveeniravlelqvgddgkrlskdaia
srtealldelqishlrenpalslsggerrrveiaralatnpsfilldepfagvdpiavle
iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdiienesvrrvyl
gehfrm
SCOPe Domain Coordinates for d4wbsa_:
Click to download the PDB-style file with coordinates for d4wbsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wbsa_:
- d4wbsa_ first appeared in SCOPe 2.04
- d4wbsa_ appears in SCOPe 2.05
- d4wbsa_ appears in SCOPe 2.07
- d4wbsa_ appears in the current release, SCOPe 2.08
View in 3D
