Lineage for d4w9uc1 (4w9u C:4-241)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246280Species Brucella abortus [TaxId:359391] [259594] (1 PDB entry)
  8. 2246283Domain d4w9uc1: 4w9u C:4-241 [259595]
    Other proteins in same PDB: d4w9ua2, d4w9ub2, d4w9uc2, d4w9ud2
    automated match to d3ii9a1
    complexed with edo

Details for d4w9uc1

PDB Entry: 4w9u (more details), 2.4 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from brucella melitensis
PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4w9uc1:

Sequence, based on SEQRES records: (download)

>d4w9uc1 e.6.1.0 (C:4-241) automated matches {Brucella abortus [TaxId: 359391]}
aafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmgqagl
lgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkky
lpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvfvvwa
ksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnvsg

Sequence, based on observed residues (ATOM records): (download)

>d4w9uc1 e.6.1.0 (C:4-241) automated matches {Brucella abortus [TaxId: 359391]}
aafawedpflleeqltedermirdsakafasdvllprvektdpelfhlmgqagllgvtlp
edygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvs
geligcfgltepmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnairgfil
ekgmkglsapkilrasitgeivmdgvevsedailpnvsg

SCOPe Domain Coordinates for d4w9uc1:

Click to download the PDB-style file with coordinates for d4w9uc1.
(The format of our PDB-style files is described here.)

Timeline for d4w9uc1: