Lineage for d4w88b_ (4w88 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (72 species)
not a true protein
Species Uncultured bacterium [TaxId:77133] [188624] (9 PDB entries) 
Domain d4w88b_: 4w88 B: [269969]
automated match to d4im4a_
complexed with bgc, gal, mg, trs, xys
Details for d4w88b_
PDB Entry: 4w88 (more details), 1.58 Å
PDB Description: crystal structure of xeg5a, a gh5 xyloglucan-specific endo-beta-1,4- glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and tris
PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanaseSCOPe Domain Sequences for d4w88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w88b_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
cfiwdnniyhgngekfgllnrsllkwynddivdayvnhaa
SCOPe Domain Coordinates for d4w88b_:
Click to download the PDB-style file with coordinates for d4w88b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4w88b_:
- d4w88b_ is new in SCOPe 2.05-stable
- d4w88b_ is called d4w88b1 in SCOPe 2.06
- d4w88b_ appears in the current release, SCOPe 2.08, called d4w88b1
View in 3D
