Lineage for d4uxha2 (4uxh A:138-179)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. Protein automated matches [190463] (9 species)
    not a true protein
  7. Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)
  8. Domain d4uxha2: 4uxh A:138-179 [345456]
    Other proteins in same PDB: d4uxha1, d4uxhb1
    automated match to d5fuwa2
    complexed with t5a, zn

Details for d4uxha2

PDB Entry: 4uxh (more details), 2.4 Å

PDB Description: leishmania major thymidine kinase in complex with ap5dt
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d4uxha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxha2 g.39.1.0 (A:138-179) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk

SCOPe Domain Coordinates for d4uxha2 are not available.

Timeline for d4uxha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uxha1
View in 3D
Domains from other chains:
(mouse over for more information)
d4uxhb1, d4uxhb2