Lineage for d4uuza_ (4uuz A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily)
core: 3 helices; long middle helix is flanked at each end with shorter onesSuperfamily a.22.1: Histone-fold [47113] (5 families) 
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
form octamers composed of two copies of each of the four histones
Protein Histone H3 [47122] (6 species) 
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (2 PDB entries) 
Domain d4uuza_: 4uuz A: [269942]
Other proteins in same PDB: d4uuzb_
automated match to d1tzyc_
protein/DNA complex
Details for d4uuza_
PDB Entry: 4uuz (more details), 2.9 Å
PDB Description: mcm2-histone complex
PDB Compounds: (A:) histone h3SCOPe Domain Sequences for d4uuza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uuza_ a.22.1.1 (A:) Histone H3 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera
SCOPe Domain Coordinates for d4uuza_:
Click to download the PDB-style file with coordinates for d4uuza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4uuza_:
- d4uuza_ first appeared in SCOPe 2.05
- d4uuza_ appears in SCOPe 2.07
View in 3D
