Lineage for d4ur6a_ (4ur6 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. Protein automated matches [191302] (4 species)
    not a true protein
  7. Species Zoarces viviparus [TaxId:48416] [258575] (2 PDB entries)
  8. Domain d4ur6a_: 4ur6 A: [259307]
    automated match to d2lx3a_
    complexed with so4

Details for d4ur6a_

PDB Entry: 4ur6 (more details), 1.2 Å

PDB Description: structure of the type iii fish antifreeze protein from zoarces viviparus zvafp6
PDB Compounds: (A:) type III antifreeze protein 6

SCOPe Domain Sequences for d4ur6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ur6a_ b.85.1.1 (A:) automated matches {Zoarces viviparus [TaxId: 48416]}
gesvvatqlipintaltpammagkvtnpsgipfaemsqivgkqvntpvakgqtlmpdmvk
tyvp

SCOPe Domain Coordinates for d4ur6a_ are not available.

Timeline for d4ur6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ur6b_