Lineage for d4uo4b_ (4uo4 B:)
- Root: SCOPe 2.05
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.0: automated matches [254278] (1 protein)
not a true familyProtein automated matches [254645] (10 species)
not a true proteinSpecies Influenza A virus [TaxId:11320] [255657] (7 PDB entries) 
Domain d4uo4b_: 4uo4 B: [258839]
Other proteins in same PDB: d4uo4a_
automated match to d4n5zb_
complexed with nag, so4
Details for d4uo4b_
PDB Entry: 4uo4 (more details), 2.6 Å
PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin
PDB Compounds: (B:) h3 haemagglutinin ha2 chainSCOPe Domain Sequences for d4uo4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo4b_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr
SCOPe Domain Coordinates for d4uo4b_:
Click to download the PDB-style file with coordinates for d4uo4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4uo4b_:
- d4uo4b_ first appeared in SCOPe 2.04
- d4uo4b_ is called d4uo4b1 in SCOPe 2.06
- d4uo4b_ appears in the current release, SCOPe 2.08, called d4uo4b1
View in 3D
