Lineage for d4ulva_ (4ulv A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.3: Cytochromes [47175] (3 families) 
Heme-containing proteins
Family a.24.3.0: automated matches [271165] (1 protein)
not a true familyProtein automated matches [271167] (4 species)
not a true proteinSpecies Shewanella frigidimarina [TaxId:56812] [271169] (2 PDB entries) 
Domain d4ulva_: 4ulv A: [271268]
automated match to d2xlea_
complexed with gol, hec, so4
Details for d4ulva_
PDB Entry: 4ulv (more details), 1.29 Å
PDB Description: cytochrome c prime from shewanella frigidimarina
PDB Compounds: (A:) cytochrome c, class IISCOPe Domain Sequences for d4ulva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ulva_ a.24.3.0 (A:) automated matches {Shewanella frigidimarina [TaxId: 56812]}
nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi
agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg
chdvykkd
SCOPe Domain Coordinates for d4ulva_:
Click to download the PDB-style file with coordinates for d4ulva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ulva_:
- d4ulva_ first appeared in SCOPe 2.05
- d4ulva_ appears in SCOPe 2.07
View in 3D
