Lineage for d4ubpa_ (4ubp A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175263Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2175264Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2175265Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2175266Protein Urease, gamma-subunit [54113] (4 species)
  7. 2175267Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)
  8. 2175268Domain d4ubpa_: 4ubp A: [37352]
    Other proteins in same PDB: d4ubpb_, d4ubpc1, d4ubpc2
    complexed with hae, ni

Details for d4ubpa_

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution
PDB Compounds: (A:) protein (urease (chain a))

SCOPe Domain Sequences for d4ubpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d4ubpa_:

Click to download the PDB-style file with coordinates for d4ubpa_.
(The format of our PDB-style files is described here.)

Timeline for d4ubpa_: