Lineage for d4uaib_ (4uai B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies)
beta(3)-alpha
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) 
form dimers with different dimerisation modesFamily d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) 
Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries) 
Domain d4uaib_: 4uai B: [260984]
automated match to d2j7za_
complexed with 3gg, so4
Details for d4uaib_
PDB Entry: 4uai (more details), 1.9 Å
PDB Description: crystal structure of cxcl12 in complex with inhibitor
PDB Compounds: (B:) Stromal cell-derived factor 1SCOPe Domain Sequences for d4uaib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uaib_ d.9.1.1 (B:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
pvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqey
lekalnk
SCOPe Domain Coordinates for d4uaib_:
Click to download the PDB-style file with coordinates for d4uaib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4uaib_:
- d4uaib_ first appeared in SCOPe 2.04
- d4uaib_ appears in SCOPe 2.07
View in 3D
