Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily) unusual fold |
Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) |
Family d.210.1.0: automated matches [227194] (1 protein) not a true family |
Protein automated matches [226921] (4 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries) |
Domain d4u7ja2: 4u7j A:173-398 [260073] Other proteins in same PDB: d4u7ja1, d4u7jb1 automated match to d1j20a2 complexed with cl, edo |
PDB Entry: 4u7j (more details), 1.75 Å
SCOPe Domain Sequences for d4u7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u7ja2 d.210.1.0 (A:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq
Timeline for d4u7ja2: