Lineage for d4u3sb2 (4u3s B:123-184)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016921Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2016922Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2016940Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2016941Protein automated matches [190928] (7 species)
    not a true protein
  7. 2016942Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (4 PDB entries)
  8. 2016945Domain d4u3sb2: 4u3s B:123-184 [275450]
    Other proteins in same PDB: d4u3sa_, d4u3sb1
    automated match to d2b59b1
    complexed with ca, nhe; mutant

Details for d4u3sb2

PDB Entry: 4u3s (more details), 1.64 Å

PDB Description: crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
PDB Compounds: (B:) cellulosomal scaffoldin

SCOPe Domain Sequences for d4u3sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u3sb2 a.139.1.0 (B:123-184) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aiggtqdgainledileickafgtsstdakyqvgldlnrdgaisledvmivakhfnkvss
dy

SCOPe Domain Coordinates for d4u3sb2:

Click to download the PDB-style file with coordinates for d4u3sb2.
(The format of our PDB-style files is described here.)

Timeline for d4u3sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u3sb1
View in 3D
Domains from other chains:
(mouse over for more information)
d4u3sa_