Lineage for d4u3sb2 (4u3s B:123-184)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.139: Type I dockerin domain [63445] (1 superfamily)
tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-handSuperfamily a.139.1: Type I dockerin domain [63446] (2 families) 
Family a.139.1.0: automated matches [191542] (1 protein)
not a true familyProtein automated matches [190928] (7 species)
not a true protein
Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries) 
Domain d4u3sb2: 4u3s B:123-184 [275450]
Other proteins in same PDB: d4u3sa_, d4u3sb1
automated match to d2b59b1
complexed with ca, nhe; mutant
Details for d4u3sb2
PDB Entry: 4u3s (more details), 1.64 Å
PDB Description: crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
PDB Compounds: (B:) cellulosomal scaffoldinSCOPe Domain Sequences for d4u3sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u3sb2 a.139.1.0 (B:123-184) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aiggtqdgainledileickafgtsstdakyqvgldlnrdgaisledvmivakhfnkvss
dy
SCOPe Domain Coordinates for d4u3sb2:
Click to download the PDB-style file with coordinates for d4u3sb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4u3sb2:
- d4u3sb2 first appeared in SCOPe 2.05
- d4u3sb2 appears in SCOPe 2.07
View in 3D
