| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
| Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
| Protein automated matches [190928] (7 species) not a true protein |
| Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries) |
| Domain d4u3sb2: 4u3s B:123-184 [275450] Other proteins in same PDB: d4u3sa_, d4u3sb1 automated match to d2b59b1 complexed with ca, nhe; mutant |
PDB Entry: 4u3s (more details), 1.64 Å
SCOPe Domain Sequences for d4u3sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u3sb2 a.139.1.0 (B:123-184) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aiggtqdgainledileickafgtsstdakyqvgldlnrdgaisledvmivakhfnkvss
dy
Timeline for d4u3sb2: