Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) |
Family b.3.2.0: automated matches [275446] (1 protein) not a true family |
Protein automated matches [275447] (3 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [275448] (2 PDB entries) |
Domain d4u3sb1: 4u3s B:29-122 [275449] Other proteins in same PDB: d4u3sa_, d4u3sb2 automated match to d2b59b2 complexed with ca, nhe; mutant |
PDB Entry: 4u3s (more details), 1.64 Å
SCOPe Domain Sequences for d4u3sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u3sb1 b.3.2.0 (B:29-122) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit kanyltreianvsvtadkelstsaspilmwagdm
Timeline for d4u3sb1: