Lineage for d4u36a_ (4u36 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391066Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2391067Domain d4u36a_: 4u36 A: [268920]
    automated match to d3n35a_
    complexed with ca, cit, mn, so4, tnr

Details for d4u36a_

PDB Entry: 4u36 (more details), 1.4 Å

PDB Description: crystal structure of a seed lectin from vatairea macrocarpa complexed with tn-antigen
PDB Compounds: (A:) seed lectin

SCOPe Domain Sequences for d4u36a_:

Sequence, based on SEQRES records: (download)

>d4u36a_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq

Sequence, based on observed residues (ATOM records): (download)

>d4u36a_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndiqtvavef
dtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltypsna
tsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq

SCOPe Domain Coordinates for d4u36a_:

Click to download the PDB-style file with coordinates for d4u36a_.
(The format of our PDB-style files is described here.)

Timeline for d4u36a_: