Lineage for d4u2ca_ (4u2c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151331Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins)
    automatically mapped to Pfam PF01738
  6. 2151337Protein automated matches [190856] (2 species)
    not a true protein
  7. 2151348Species Pseudomonas sp. [TaxId:65741] [258104] (7 PDB entries)
  8. 2151356Domain d4u2ca_: 4u2c A: [261607]
    automated match to d1zi6a_
    complexed with so4

Details for d4u2ca_

PDB Entry: 4u2c (more details), 1.95 Å

PDB Description: crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution
PDB Compounds: (A:) Carboxymethylenebutenolidase

SCOPe Domain Sequences for d4u2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u2ca_ c.69.1.9 (A:) automated matches {Pseudomonas sp. [TaxId: 65741]}
mltegitiqsydghtfgalvgspvkapapviviaheilgvnafmretvswlvdqgyaavc
pdlyarqapgtaldpqdeaqreqayklwqafdmeagvgdleaairyarhlpysngkvglv
gyslggalaflvaakgyvdravgycgvglekqlnkvpevkhpalfhmggqdhfvpapsrq
litegfganpllqvhwyegaghsfartgssgyvasaaalanertldflaplqs

SCOPe Domain Coordinates for d4u2ca_:

Click to download the PDB-style file with coordinates for d4u2ca_.
(The format of our PDB-style files is described here.)

Timeline for d4u2ca_: