Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Bradyrhizobium diazoefficiens [TaxId:224911] [260057] (3 PDB entries) |
Domain d4txod_: 4txo D: [260445] Other proteins in same PDB: d4txoa_, d4txoc_, d4txoe_, d4txog_ automated match to d2gqla_ complexed with na, peg, scn |
PDB Entry: 4txo (more details), 2.2 Å
SCOPe Domain Sequences for d4txod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4txod_ c.47.1.0 (D:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]} paaiggpfqltdqngkavtdkslkgkptliffgythspdvcptslfeisevlramgkdad kvnaifisvdperdtpatmknylssfdphleglsgdpaeiakvitsyrvyakkvptkdgd ytmdhtaliylmdrdgrfvspfnlkrtpeeaaadlkryl
Timeline for d4txod_: