Lineage for d4tvsa_ (4tvs a:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries) 
Domain d4tvsa_: 4tvs a: [260054]
automated match to d4heme_
complexed with gol, so4
Details for d4tvsa_
PDB Entry: 4tvs (more details), 1.6 Å
PDB Description: LAP1(aa356-583), H.sapiens, bound to VHH-BS1
PDB Compounds: (a:) VHH Domain BS-1SCOPe Domain Sequences for d4tvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvsa_ b.1.1.1 (a:) automated matches {Vicugna pacos [TaxId: 30538]}
mqvqlvesggglvqaggslrlscaasgrtlssyavgwfrqapglerefvatisrsggsth
yadsvkgrftisrdnakntvylqmnslkpedtavyycaatftpdgswyytrgssydywgq
gtqvtvss
SCOPe Domain Coordinates for d4tvsa_:
Click to download the PDB-style file with coordinates for d4tvsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4tvsa_:
- d4tvsa_ first appeared in SCOPe 2.04
- d4tvsa_ is called d4tvsa1 in SCOPe 2.06
- d4tvsa_ appears in the current release, SCOPe 2.08, called d4tvsa1
View in 3D
