Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [261699] (4 PDB entries) |
Domain d4ttra_: 4ttr A: [261701] automated match to d1jjva_ complexed with bu2, po4 |
PDB Entry: 4ttr (more details), 2.1 Å
SCOPe Domain Sequences for d4ttra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttra_ c.37.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]} mvysvgltgniasgkstvaeffselginviyadkiakeltskntpcyqdiishfgssvvl nngeldrkrirdiifsnsnerlwlesllhpvirkkieeqlivctspyclieipllfnkhh ypylqkvllviaplesqldrivkrdhctkkqalailatqpnleqrleaaddvlinesgls elkakvnklhqkylreakikq
Timeline for d4ttra_: