| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Death-associated protein kinase, Dap [75560] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries) Uniprot P53355 2-285 |
| Domain d4tl0a_: 4tl0 A: [273730] automated match to d2x0ga_ complexed with gol, mg, nh4; mutant |
PDB Entry: 4tl0 (more details), 2.7 Å
SCOPe Domain Sequences for d4tl0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tl0a_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaeavnmekfkkfaa
Timeline for d4tl0a_: