Lineage for d4s0oa_ (4s0o A:)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
multi-helical domains of various folds which is thought to unfold in the membraneSuperfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) 
PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domainFamily f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
Pfam PF00452
Protein Proapoptotic molecule Bax [56862] (3 species) Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries) 
Domain d4s0oa_: 4s0o A: [319814]
automated match to d2k7wa_
Details for d4s0oa_
PDB Entry: 4s0o (more details), 1.9 Å
PDB Description: crystal structure of the autoinhibited dimer of pro-apoptotic bax (i)
PDB Compounds: (A:) Apoptosis regulator BAXSCOPe Domain Sequences for d4s0oa_:
Sequence, based on SEQRES records: (download)
>d4s0oa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds
nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel
irtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg
Sequence, based on observed residues (ATOM records): (download)
>d4s0oa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdraeapelaldpvpqdastkklseclkrigdeldsnmelq
rmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpelirtim
gwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg
SCOPe Domain Coordinates for d4s0oa_:
Click to download the PDB-style file with coordinates for d4s0oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4s0oa_:
- d4s0oa_ first appeared in SCOPe 2.06
- d4s0oa_ appears in SCOPe 2.07
View in 3D
