Lineage for d4rtia_ (4rti A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968341Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2968342Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2968348Family d.107.1.2: PsbP-like [111092] (2 proteins)
    Pfam PF01789
  6. 2968353Protein automated matches [196539] (3 species)
    not a true protein
  7. 2968359Species Spinach (Spinacia oleracea) [TaxId:3562] [196540] (2 PDB entries)
  8. 2968361Domain d4rtia_: 4rti A: [269870]
    automated match to d2vu4a_
    complexed with cl, mn

Details for d4rtia_

PDB Entry: 4rti (more details), 1.8 Å

PDB Description: the crystal structure of psbp from spinacia oleracea
PDB Compounds: (A:) Oxygen-evolving enhancer protein 2, chloroplastic

SCOPe Domain Sequences for d4rtia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rtia_ d.107.1.2 (A:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
pkkntefmpyngdgfkllvpskwnpskekefpgqvlryednfdatsnlsvlvqptdkksi
tdfgspedflsqvdyllgkqayfgktdseggfdsgvvasanvlesstpvvdgkqyysitv
ltrtadgdeggkhqviaatvkdgklyickaqagdkrwfkgakkfvesatssfsva

SCOPe Domain Coordinates for d4rtia_:

Click to download the PDB-style file with coordinates for d4rtia_.
(The format of our PDB-style files is described here.)

Timeline for d4rtia_: