Lineage for d4rq9a1 (4rq9 A:16-130)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.0: automated matches [191387] (1 protein)
not a true familyProtein automated matches [190492] (24 species)
not a true protein
Species Stigmatella aurantiaca [TaxId:378806] [317293] (3 PDB entries) 
Domain d4rq9a1: 4rq9 A:16-130 [317294]
Other proteins in same PDB: d4rq9a2
automated match to d2oola2
complexed with bla, edo, gol, srt; mutant
Details for d4rq9a1
PDB Entry: 4rq9 (more details), 2.5 Å
PDB Description: crystal structure of the chromophore-binding domain of stigmatella aurantiaca bacteriophytochrome (thr289his mutant) in the pr state
PDB Compounds: (A:) Photoreceptor-histidine kinase BphPSCOPe Domain Sequences for d4rq9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rq9a1 d.110.3.0 (A:16-130) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
tncdrepihipgaiqphgvllvlsepglvlthasenapavlgnsaeqllgaplghfieps
vrepleadlrsarlkqlnplkvvwrvdgvdrffdgiahrhqgrlilelepsshre
SCOPe Domain Coordinates for d4rq9a1:
Click to download the PDB-style file with coordinates for d4rq9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4rq9a1:
- d4rq9a1 first appeared in SCOPe 2.06
- d4rq9a1 appears in SCOPe 2.07
View in 3D
