Lineage for d4ropa1 (4rop A:5-142)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.0: automated matches [227195] (1 protein)
not a true familyProtein automated matches [226922] (95 species)
not a true protein
Species Synechococcus elongatus [TaxId:269084] [261949] (2 PDB entries) 
Domain d4ropa1: 4rop A:5-142 [261950]
Other proteins in same PDB: d4ropa2
automated match to d2xsxa1
complexed with ca, cl, mg
Details for d4ropa1
PDB Entry: 4rop (more details), 2.05 Å
PDB Description: crystal structure of enolase from synechococcus elongatus
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d4ropa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ropa1 d.54.1.0 (A:5-142) automated matches {Synechococcus elongatus [TaxId: 269084]}
ygtqiaeitareildsrgrptveaevhledgsvglaqvpsgastgtfeahelrdddpsry
ggkgvqkavenvsaiedaliglsaldqegldkamialdgtpnkknlganailavslatah
aaatslnlplyrylggpl
SCOPe Domain Coordinates for d4ropa1:
Click to download the PDB-style file with coordinates for d4ropa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ropa1:
- d4ropa1 first appeared in SCOPe 2.04
- d4ropa1 appears in SCOPe 2.07
View in 3D
