Lineage for d4rgos1 (4rgo S:2-121)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-keySuperfamily b.40.2: Bacterial enterotoxins [50203] (3 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries) 
Domain d4rgos1: 4rgo S:2-121 [268735]
Other proteins in same PDB: d4rgol1, d4rgol2, d4rgos2
automated match to d3seba1
complexed with act
Details for d4rgos1
PDB Entry: 4rgo (more details), 1.8 Å
PDB Description: structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
PDB Compounds: (S:) enterotoxin type bSCOPe Domain Sequences for d4rgos1:
Sequence, based on SEQRES records: (download)
>d4rgos1 b.40.2.2 (S:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh
Sequence, based on observed residues (ATOM records): (download)
>d4rgos1 b.40.2.2 (S:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvteh
SCOPe Domain Coordinates for d4rgos1:
Click to download the PDB-style file with coordinates for d4rgos1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4rgos1:
- d4rgos1 first appeared in SCOPe 2.05
- d4rgos1 appears in SCOPe 2.06
- d4rgos1 appears in the current release, SCOPe 2.08
View in 3D
