Lineage for d4ra8b_ (4ra8 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175656Protein automated matches [190403] (3 species)
    not a true protein
  7. 2175657Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries)
  8. 2175703Domain d4ra8b_: 4ra8 B: [263837]
    mutant

Details for d4ra8b_

PDB Entry: 4ra8 (more details), 2.6 Å

PDB Description: structure analysis of the mip1a p8a mutant
PDB Compounds: (B:) C-C motif chemokine 3

SCOPe Domain Sequences for d4ra8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ra8b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
kyvsdlels

SCOPe Domain Coordinates for d4ra8b_:

Click to download the PDB-style file with coordinates for d4ra8b_.
(The format of our PDB-style files is described here.)

Timeline for d4ra8b_: