Lineage for d4r7ta_ (4r7t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922342Protein automated matches [191092] (2 species)
    not a true protein
  7. 2922346Species Vibrio cholerae [TaxId:243277] [260006] (2 PDB entries)
  8. 2922351Domain d4r7ta_: 4r7t A: [263822]
    automated match to d4r7tc_
    complexed with cl, fmt, gol, mg

Details for d4r7ta_

PDB Entry: 4r7t (more details), 2.1 Å

PDB Description: crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d4r7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7ta_ c.124.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
epstqelkvktvkyfteleaknivgf

SCOPe Domain Coordinates for d4r7ta_:

Click to download the PDB-style file with coordinates for d4r7ta_.
(The format of our PDB-style files is described here.)

Timeline for d4r7ta_: