| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries) |
| Domain d4r1na2: 4r1n A:184-282 [275397] Other proteins in same PDB: d4r1na1, d4r1nb1, d4r1nc1, d4r1nd1 automated match to d4kuga2 |
PDB Entry: 4r1n (more details), 1.8 Å
SCOPe Domain Sequences for d4r1na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1na2 a.100.1.0 (A:184-282) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydysk
Timeline for d4r1na2: