Lineage for d4qr0a_ (4qr0 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) 
contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
Family d.58.58.0: automated matches [191564] (1 protein)
not a true familyProtein automated matches [190980] (6 species)
not a true protein
Species Streptococcus pyogenes [TaxId:301447] [261263] (3 PDB entries) 
Domain d4qr0a_: 4qr0 A: [261264]
automated match to d2i0xa1
Details for d4qr0a_
PDB Entry: 4qr0 (more details), 2.4 Å
PDB Description: Crystal structure of Streptococcus pyogenes Cas2 at pH 5.6
PDB Compounds: (A:) CRISPR-associated endoribonuclease Cas2SCOPe Domain Sequences for d4qr0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qr0a_ d.58.58.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mmvlvtydvntetpagrkrlrhvaklcvdygqrvqnsvfecsvtpaefvdikhrltqiid
ektdsirfyllgknwqrrvetlg
SCOPe Domain Coordinates for d4qr0a_:
Click to download the PDB-style file with coordinates for d4qr0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qr0a_:
- d4qr0a_ first appeared in SCOPe 2.04
- d4qr0a_ appears in SCOPe 2.07
View in 3D
