Lineage for d4qqua2 (4qqu A:404-767)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.22: UROD/MetE-like [51726] (3 families) 
Family c.1.22.0: automated matches [191464] (1 protein)
not a true familyProtein automated matches [190717] (5 species)
not a true protein
Species Yeast (Candida albicans) [TaxId:5476] [267869] (5 PDB entries) 
Domain d4qqua2: 4qqu A:404-767 [268614]
automated match to d3ppha2
complexed with 39s, hcs, po4, zn
Details for d4qqua2
PDB Entry: 4qqu (more details), 2.98 Å
PDB Description: Crystal structure of the cobalamin-independent methionine synthase enzyme in a closed conformation
PDB Compounds: (A:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferaseSCOPe Domain Sequences for d4qqua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qqua2 c.1.22.0 (A:404-767) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa
kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw
vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv
sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv
atsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnhiglgl
fdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakef
raky
SCOPe Domain Coordinates for d4qqua2:
Click to download the PDB-style file with coordinates for d4qqua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qqua2:
- d4qqua2 first appeared in SCOPe 2.05
- d4qqua2 appears in SCOPe 2.06
- d4qqua2 appears in the current release, SCOPe 2.08
View in 3D
