Lineage for d4qppa_ (4qpp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502371Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 2502453Domain d4qppa_: 4qpp A: [259103]
    automated match to d4hc4a_
    complexed with 36s, sah

Details for d4qppa_

PDB Entry: 4qpp (more details), 2.52 Å

PDB Description: the crystal structure of human hmt1 hnrnp methyltransferase-like protein 6 in complex with compound ds-421 (2-{4-[3-chloro-2-(2- methoxyphenyl)-1h-indol-5-yl]piperidin-1-yl}-n-methylethanamine
PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d4qppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qppa_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yyecysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifcaqagar
rvyaveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygllhesm
lssvlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsclegfa
trclmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscygsapmh
gfaiwfqvtfpggesekplvlstspfhpathwkqallylnepvqveqdtdvsgeitllps
rdnprrlrvllrykvgdqeektkdfamed

SCOPe Domain Coordinates for d4qppa_:

Click to download the PDB-style file with coordinates for d4qppa_.
(The format of our PDB-style files is described here.)

Timeline for d4qppa_: