Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
Protein automated matches [190796] (4 species) not a true protein |
Species Escherichia coli [TaxId:83333] [260567] (1 PDB entry) |
Domain d4qakb_: 4qak B: [260568] automated match to d1iuha_ complexed with 2am, gol |
PDB Entry: 4qak (more details), 2.02 Å
SCOPe Domain Sequences for d4qakb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qakb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} epqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsl lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpf hphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
Timeline for d4qakb_: