Lineage for d4q4la1 (4q4l A:18-91)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067402Species Burkholderia thailandensis [TaxId:271848] [257611] (1 PDB entry)
  8. 2067403Domain d4q4la1: 4q4l A:18-91 [257612]
    Other proteins in same PDB: d4q4la2, d4q4la3
    automated match to d1mabb2
    complexed with na

Details for d4q4la1

PDB Entry: 4q4l (more details), 2.2 Å

PDB Description: Crystal structure of an ATP synthase subunit beta 1 (F1-B1) from Burkholderia thailandensis
PDB Compounds: (A:) ATP synthase subunit beta 1

SCOPe Domain Sequences for d4q4la1:

Sequence, based on SEQRES records: (download)

>d4q4la1 b.49.1.0 (A:18-91) automated matches {Burkholderia thailandensis [TaxId: 271848]}
alvegkivqcigavidvefpresmpkiydalilegseltlevqqqlgdgvvrticlgasd
glrrgvvvkntgnp

Sequence, based on observed residues (ATOM records): (download)

>d4q4la1 b.49.1.0 (A:18-91) automated matches {Burkholderia thailandensis [TaxId: 271848]}
alvegkivqcigavidvefpresmpkiydalilegseltlevqqqlgdgvvrticlgalr
rgvvvkntgnp

SCOPe Domain Coordinates for d4q4la1:

Click to download the PDB-style file with coordinates for d4q4la1.
(The format of our PDB-style files is described here.)

Timeline for d4q4la1: