Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (11 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [257611] (1 PDB entry) |
Domain d4q4la1: 4q4l A:18-91 [257612] Other proteins in same PDB: d4q4la2, d4q4la3 automated match to d1mabb2 complexed with na |
PDB Entry: 4q4l (more details), 2.2 Å
SCOPe Domain Sequences for d4q4la1:
Sequence, based on SEQRES records: (download)
>d4q4la1 b.49.1.0 (A:18-91) automated matches {Burkholderia thailandensis [TaxId: 271848]} alvegkivqcigavidvefpresmpkiydalilegseltlevqqqlgdgvvrticlgasd glrrgvvvkntgnp
>d4q4la1 b.49.1.0 (A:18-91) automated matches {Burkholderia thailandensis [TaxId: 271848]} alvegkivqcigavidvefpresmpkiydalilegseltlevqqqlgdgvvrticlgalr rgvvvkntgnp
Timeline for d4q4la1: