Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries) |
Domain d4q2na_: 4q2n A: [259465] automated match to d3cbxa_ complexed with edo |
PDB Entry: 4q2n (more details), 2 Å
SCOPe Domain Sequences for d4q2na_:
Sequence, based on SEQRES records: (download)
>d4q2na_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmetynvelvrkdgqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndki vavdgvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi
>d4q2na_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmetynvelvrkdgqslgirivgysgiyvksiipgsaayhnghiqvndkivavdgvniq gfanhdvvevlrnagqvvhltlvrrgggwfldi
Timeline for d4q2na_: